.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ciw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray Structure of the [FeFe]-Hydrogenase Maturase HydE from Thermotoga maritima. J.Biol.Chem. 283 18861-18872 2008
    Site OTHER
    PDB Id 3ciw Target Id PDB3CIW
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26081, TM1269 Molecular Weight 39797.16 Da.
    Residues 348 Isoelectric Point 8.50
    Sequence mtgreileklerreftrevlkealsindrgfnealfkladeirrkyvgdevhiraiiefsnvcrknclyc glrrdnknlkryrmtpeeiverarlavqfgaktivlqsgedpyympdvisdivkeikkmgvavtlslge wpreyyekwkeagadryllrhetanpvlhrklrpdtsfenrlnclltlkelgyetgagsmvglpgqtid dlvddllflkehdfdmvgigpfiphpdtplanekkgdftltlkmvaltrillpdsnipattamgtivpg greitlrcganvimpnwtpspyrqlyqlypgkicvfekdtacipcvmkmiellgrkpgrdwggrkrvfetv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.35 Rfree 0.17713
    Matthews' coefficent 2.17 Rfactor 0.14335
    Waters 426 Solvent Content 43.43

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands SF4-SAH (IRON/SULFUR) x 1;CPS (S-ADENOSYL-L-HOMOCYSTEINE) x 5;SAT (3-[(3-CHOLAMIDOPROPYL)DIMETHYLAMMONIO]-1-) x 1
    Metals CL (CHLORIDE) x 3

    Jmol

     
    Google Scholar output for 3ciw

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch