.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gha

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title T. maritima maltotriose binding protein. To be Published
    Site OTHER
    PDB Id 2gha Target Id PDB2GHA
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS26061, TM1204 Molecular Weight 42175.22 Da.
    Residues 382 Isoelectric Point 5.04
    Sequence mqpkltiwcsekqvdilqklgeefkakygvevevqyvnfqdikskfltaapegqgadiivgahdwvgela vngliepipnfsdlknfyetalnafsyggklygipyameaialiynkdyvpeppktmdelieiakqide efggevrgfitsaaefyyiapfifgyggyvfkqtekgldvndiglanegaikgvkllkrlvdegildps dnyqimdsmfregqaamiingpwaikaykdagidygvapipdlepgvparpfvgvqgfmvnakspnkll aiefltsfiakketmyriylgdprlpsrkdvlelvkdnpdvvgftlsaangipmpnvpqmaavwaamnd alnlvvngkatveealknaverikaqiqgshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.196
    Matthews' coefficent 2.07 Rfactor 0.162
    Waters 707 Solvent Content 40.46

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands MLR (MALTOTRIOSE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2gha

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch