.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fn8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Ligand-induced conformational changes in a thermophilic ribose-binding protein. Bmc Struct.Biol. 8 50-50 2008
    Site OTHER
    PDB Id 2fn8 Target Id PDB2FN8
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS26079, TM0958 Molecular Weight 33792.53 Da.
    Residues 303 Isoelectric Point 5.33
    Sequence mkgkmaivistlnnpwfvvlaetakqraeqlgyeatifdsqndtakesahfdaiiaagydaiifnptdad gsianvkrakeagipvfcvdrginarglavaqiysdnyyggvlmgeyfvkflkekypdakeipyaellg ilsaqptwdrsngfhsvvdqypefkmvaqqsaefdrdtaykvteqilqahpeikaiwcgndamalgamk aceaagrtdiyifgfdgaedvinaikegkqivatimqfpklmarlavewadqylrgersfpeivpvtve lvtrenidkytaygrkeegshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.15 Rfree 0.223
    Matthews' coefficent 3.43 Rfactor 0.193
    Waters 142 Solvent Content 64.12

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands RIP (RIBOSE(PYRANOSE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2fn8

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch