The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural analysis of a set of proteins resulting from a bacterial genomics project. Proteins 60 787-796 2005
    Site OTHER
    PDB Id 1vho Target Id PDB1VHO
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26105, TM1048 Molecular Weight 37910.59 Da.
    Residues 346 Isoelectric Point 5.74
    Sequence mslkmetgkllmelsnldgpsgyetnvvsyiksviepfvdeakttrhgsligykkgkgigklaffahvde igfvvskvegqfarlepvggvdpkvvyaskvriytkngiergvigmlaphlqdsesrkkvptydeifvd lslcergvrvgdiavidqtafetngkvvgkaldnrascgvlvkvleflkrydhpwdvyvvfsvqeetgc lgaltgayeinpdaaivmdvtfaseppfsdhielgkgpviglgpvvdrnlvqkiieiakkhnvslqeea vggrsgtetdfvqlvrngvrtslisiplkymhtpvemvdprdveelarllslvaveleveggshhhhhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.86 Rfree 0.245
    Matthews' coefficent Rfactor 0.212
    Waters 245 Solvent Content

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands CAC (CACODYLATE) x 2;SO4 (SULFATE) x 2


    Google Scholar output for 1vho

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch