.
The Open Protein Structure Annotation Network
PDB Keyword
.

2haf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative translation repressor from Vibrio cholerae. To be Published
    Site NYSGXRC
    PDB Id 2haf Target Id NYSGXRC-2801c
    Molecular Characteristics
    Source Vibrio cholerae
    Alias Ids TPS7744,PF02622, ZP_01678038.1 Molecular Weight 21903.56 Da.
    Residues 198 Isoelectric Point 4.97
    Sequence snhssdievghsmnltnhflvampsmkdpyfkrsviyicehnqdgamglminapiditvggmlkqvdie paypqshqenlkkpvfnggpvsedrgfilhrprdhyessmkmtddiavttskdiltvlgteaepegyiv algysgwsagqleveltenswltieadpelifntpvhekwqkaiqklgispaqlssdagh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.88 Rfree 0.288
    Matthews' coefficent 2.57 Rfactor 0.241
    Waters 21 Solvent Content 52.13

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2haf

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch