| Title | Crystal structure of PrfA, the transcriptional regulator in Listeria monocytogenes. To be Published | | Site | NYSGXRC | | PDB Id | 1omi | Target Id | NYSGXRC-T143 | | Molecular Characteristics | | Source | Listeria monocytogene | | Alias Ids | P22262, | Molecular Weight | 28317.17 Da. | | Residues | 248 | Isoelectric Point | 8.66 | | Sequence | gshmasmtggqqmgrgsefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimn lqyykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlqkqvsysl akfndfsingklgsicgqlliltyvygketpdgikitldnltmqelgyssgiahssavsriisklkqek vivyknscfyvqnldylkryapkldewfylacpatwgkln | | | BLAST FFAS ProFunc GPSS |
| Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.80 | Rfree | 0.278 | | Matthews' coefficent | 2.62 | Rfactor | 0.244 | | Waters | | Solvent Content | 51.29 |
| Ligand Information | | Ligands | GOL (GLYCEROL) x 2 | | Metals | | | |
