| Title | High-quality homology models derived from NMR and X-ray structures of E. coli proteins YgdK and Suf E suggest that all members of the YgdK/Suf E protein family are enhancers of cysteine desulfurases. Protein Sci. 14 1597-1608 2005 | | Site | NESGC | | PDB Id | 1ni7 | Target Id | ER75 | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | 3.90.1010.10, 5630, | Molecular Weight | 15939.40 Da. | | Residues | 147 | Isoelectric Point | 6.11 | | Sequence | mtnpqfaghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiagcenrvwlgyt vaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelglraqlsasrsqglnalsea iiaatkqv | | | BLAST FFAS ProFunc GPSS |
| Structure Determination | | Method | NMR | Chains | 1 | | Resolution (Å) | not | Rfree | | | Matthews' coefficent | | Rfactor | | | Waters | | Solvent Content | |
| Ligand Information | | Ligands | | | Metals | | | |
