The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site Midwest Center for Structural Genomics
    Status Crystallized
    Target Id APC5793
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS4833, Molecular Weight 15271.71 Da.
    Residues 134 Isoelectric Point 4.73
    Sequence mrngslivetlislflilltvvifttiivgvaknvtfteesietflftnfaydflskyevgheieqgvyeeinref wkdkwndqnppfphidpsvstvedvalpsssdvkykkitlkikinegasieriviigd
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch