.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kkd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a Putative TetR Transcriptional Regulator (PA3699) from Pseudomonas Aeruginosa PA01. To be Published
    Site MCSG
    PDB Id 3kkd Target Id APC5591
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4704,NP_252389, 208964 Molecular Weight 26343.56 Da.
    Residues 237 Isoelectric Point 5.49
    Sequence msrvaprdsaaqaasavaesvryqgrkasrqgseqrrqaildaamrlivrdgvravrhravaaeaqvpl sattyyfkdiddlitdtfalfvernaealsafwssvegdlqemaavladdpgargslverivelavqyv qvqlterrehllaeqafrqeallnprlreladahqrilslgavhffqvlgsgqpeqdakvltsiilqme yqglvdgveqlavdemrailrrylnlvmgl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.26182
    Matthews' coefficent 1.90 Rfactor 0.20408
    Waters 92 Solvent Content 35.27

    Ligand Information
    Ligands PGE (TRIETHYLENE) x 2;SO4 (SULFATE) x 2;15P (POLYETHYLENE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3kkd

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch