.
The Open Protein Structure Annotation Network
PDB Keyword
.

3k6r

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Protein Ph0793 from Pyrococcus Horikoshii. To be Published
    Site MCSG
    PDB Id 3k6r Target Id APC5737
    Molecular Characteristics
    Source Pyrococcus horikoshii ot3
    Alias Ids TPS4792,BAA29886.1, 70601 Molecular Weight 32149.14 Da.
    Residues 278 Isoelectric Point 9.38
    Sequence mrtqgikprireilskelpeelvkllpkrwvrigdvlllplrpelepykhriaevyaevlgvktvlrkg hihgetrkpdyellygsdtvtvhvengikykldvakimfspanvkervrmakvakpdelvvdmfagigh lslpiavygkakviaiekdpytfkflvenihlnkvedrmsaynmdnrdfpgeniadrilmgyvvrthef ipkalsiakdgaiihyhntvpeklmprepfetfkritkeygydveklnelkikryapgvwhvvldlrvfks
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.25583
    Matthews' coefficent 2.46 Rfactor 0.21099
    Waters 93 Solvent Content 50.06

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3k6r
    1. Structure-Function Analysis of Human TYW2 Enzyme Required for the
    V Rodriguez, S Vasudevan, A Noma, BA Carlson - 2012 - biomedsearch.com
     
    2. Structure-Function Analysis of Human TYW2 Enzyme Required for the Biosynthesis of a Highly Modified Wybutosine (yW) Base in Phenylalanine-tRNA
    V Rodriguez, S Vasudevan, A Noma, BA Carlson - PloS one, 2012 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch