.
The Open Protein Structure Annotation Network
PDB Keyword
.

3k6c

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Protein Ne0167 from Nitrosomonas Europaea. To be Published
    Site MCSG
    PDB Id 3k6c Target Id APC5620
    Molecular Characteristics
    Source Nitrosomonas europaea atcc 19718
    Alias Ids TPS4725,NP_840261.1, 228410 Molecular Weight 11247.03 Da.
    Residues 95 Isoelectric Point 4.97
    Sequence mandgyfeptqelsdetrdmhraiislreeleavdlynqrvnackdkelkailahnrdeekehaamlle wirrcdpafdkelkdylftnkpiahe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 10
    Resolution (Å) 2.20 Rfree 0.26139
    Matthews' coefficent 2.30 Rfactor 0.22075
    Waters 344 Solvent Content 45.10

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3k6c
    1. ProBiS-Database: Pre-calculated Binding Site Similarities and Local Pairwise Alignments of PDB
    J Konc, T Cesnik, J Trykowska Konc - Journal of Chemical , 2012 - ACS Publications
     
    2. Symerythrin structures at atomic resolution and the origins of rubrerythrins and the ferritin-like superfamily
    RB Cooley, DJ Arp, PA Karplus - Journal of Molecular Biology, 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch