.
The Open Protein Structure Annotation Network
PDB Keyword
.

3iuv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of a member of TetR family (SCO1917) from Streptomyces coelicolor A3. To be Published
    Site MCSG
    PDB Id 3iuv Target Id APC6223
    Molecular Characteristics
    Source Streptomyces coelicolor a3
    Alias Ids TPS5040,NP_626183.1, 100226 Molecular Weight 21067.67 Da.
    Residues 197 Isoelectric Point 5.39
    Sequence mprrhdperrqriidaairvvgqkgiaglshrtvaaeadvplgsttyhfatlddlmvaalrqanegfar vvaahpalsdpeadlsgelarvlgewlggdrtgveleyelylaalrrpalrpvaaewaegvgallaart dpttaralvavldgiclqvlltdtpydeeyarevltrlipvpatrdgrgpgshppatag
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.55 Rfree 0.2882
    Matthews' coefficent 2.51 Rfactor 0.2407
    Waters Solvent Content 51.05

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3iuv

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch