The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of AsnC family transcriptional regulator from Agrobacterium tumefaciens. To be Published
    Site MCSG
    PDB Id 3i4p Target Id APC5879
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS4894,NP_532565.1, 176299 Molecular Weight 18748.78 Da.
    Residues 162 Isoelectric Point 5.98
    Sequence mdrldrkilrilqedstlavadlakkvglsttpcwrriqkmeedgvirrrvalldpvkvntkvtvfvsi rtashsiewlkrfsevvsefpevvefyrmsgdvdyllrvvvpdiaaydafykrmiakieirdvssafam eqikyttelpldymlldnpksgee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.214
    Matthews' coefficent 3.32 Rfactor 0.188
    Waters 117 Solvent Content 62.91

    Ligand Information
    Ligands ACT (ACETATE) x 1
    Metals CL (CHLORIDE) x 5;CA (CALCIUM) x 1


    Google Scholar output for 3i4p

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch