The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and ligand specificity of SCO4454, a TetR-family transcriptional regulator from Streptomyces coelicolor. To be Published
    Site MCSG
    PDB Id 3g7r Target Id APC6239
    Molecular Characteristics
    Source Streptomyces coelicolor a3
    Alias Ids TPS5048,NP_628621.1, 100226 Molecular Weight 21305.79 Da.
    Residues 200 Isoelectric Point 6.15
    Sequence mspsteaaartpseararllgtatrifyaegihsvgidritaeaqvtratlyrhfsgkddlilayldqa drgiraqvtaargsspaadgqvravarsivdgirspgfrgcaflnavaeypdpahpvhravlahrqwfl dtvtellaqvgdgdgvaagrhlvmlrdgamaagclfdpelvsetflhgvegvlrdvsektsa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.38 Rfree 0.17364
    Matthews' coefficent 2.41 Rfactor 0.14958
    Waters 668 Solvent Content 48.96

    Ligand Information
    Metals IOD (IODIDE) x 3;NA (SODIUM) x 2;CL (CHLORIDE) x 3


    Google Scholar output for 3g7r

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch