The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of transcriptional regulator (MarR family) from Rhodococcus sp. RHA1. To be Published
    Site MCSG
    PDB Id 3fm5 Target Id APC5972
    Molecular Characteristics
    Source Rhodococcus sp. rha1
    Alias Ids TPS4962,RHA03700, 101510 Molecular Weight 15810.13 Da.
    Residues 146 Isoelectric Point 5.09
    Sequence maesqalsddigfllsrvggmvlgavnkalvptglrvrsysvlvlaceqaegvnqrgvaatmgldpsqi vglvdeleerglvvrtldpsdrrnkliaateegrrlrddakarvdaahgryfegipdtvvnqmrdtlqs iafptfve
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.00 Rfree 0.2398
    Matthews' coefficent 2.30 Rfactor 0.1941
    Waters 294 Solvent Content 46.58

    Ligand Information
    Ligands GOL (GLYCEROL) x 2;EDO (1,2-ETHANEDIOL) x 2
    Metals MG (MAGNESIUM) x 1;CL (CHLORIDE) x 1


    Google Scholar output for 3fm5

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch