.
The Open Protein Structure Annotation Network
PDB Keyword
.

3fbs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the oxidoreductase from Agrobacterium tumefaciens. To be Published 2008
    Site MCSG
    PDB Id 3fbs Target Id APC6127
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS5015,NP_530944.1, 176299 Molecular Weight 31857.71 Da.
    Residues 297 Isoelectric Point 6.21
    Sequence mkfdviiiggsyaglsaalqlgrarknillvdagerrnrfashshgflgqdgkapgeiiaearrqiery ptihwvegrvtdakgsfgefiveidggrretagrlilamgvtdelpeiaglrerwgsavfhcpychgye ldqgkigviaaspmaihhalmlpdwgettfftngivepdadqhallaargvrvettrireiaghadvvl adgrsialaglftqpklritvdwieklgcaveegpmgstivtdpmkqttargifacgdvarpagsvala vgdgamagaaahrsilfpemr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.15 Rfree 0.23626
    Matthews' coefficent 2.65 Rfactor 0.18755
    Waters 325 Solvent Content 53.57

    Ligand Information
    Ligands FAD (FLAVIN-ADENINE) x 2;SO4 (SULFATE) x 3
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 3fbs

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch