.
The Open Protein Structure Annotation Network
PDB Keyword
.

3e7q

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the putative transcriptional regulator from Pseudomonas aeruginosa PAO1. To be Published
    Site MCSG
    PDB Id 3e7q Target Id APC5941
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4948,NP_253671.1, 208964 Molecular Weight 23415.39 Da.
    Residues 215 Isoelectric Point 5.70
    Sequence mnqevrfsrlepeqrkallieatlaclkrhgfqgasvrkicaeagvsvglinhhydgkdalvaeaylav tgrvmrllrgaidtapggarprlsaffeasfsaelldpqlldawlafwgavgsieaigrvhdhsygeyr allvgvlrqlaeeggwadfdaelaaislsalldglwlesglnpatftprqgvqiceawvdgleagahrr frrameac
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.26551
    Matthews' coefficent 2.63 Rfactor 0.21389
    Waters 133 Solvent Content 53.15

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3e7q

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch