.
The Open Protein Structure Annotation Network
PDB Keyword
.

3drw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of an ADP-dependent 6-phosphofructokinase from pyrococcus horikoshii OT3. To be Published
    Site MCSG
    PDB Id 3drw Target Id APC5054
    Related PDB Ids 1u2x 
    Molecular Characteristics
    Source Pyrococcus horikoshii
    Alias Ids TPS4664,O59355, 53953 Molecular Weight 51749.84 Da.
    Residues 450 Isoelectric Point 6.41
    Sequence mipehlsiytaynanidaivklnqetiqnlinafdpdevkrrieeypreinepidfvarlvhtlklgkp aavplvnekmnewfdktfryeeerlggqagiiantlaglkirkviaytpflpkrlaelfkkgvlypvve ngelqfkpiqeayregdplkinrifefrkglkfklgdetieipnsgrfivsarfesisrietredikpf lgeigkevdgaifsgyqglrtkysdgkdanyylrrakediiefkekdvkihvefasvqdrklrkkiitn ilpfvdsvgideaeiaqilsvlgyreladriftynrledsilggmiildelnfeilqvhttyylmyith rdnplseeelakslefgttlaaaraslgdirgpddykvglkvpfnerseyvklrfeeaksrlrmreykv vviptrlvqnpvltvglgdtisagafltyleflkrh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.2244
    Matthews' coefficent 2.24 Rfactor 0.17161
    Waters 576 Solvent Content 45.05

    Ligand Information
    Ligands AMP (ADENOSINE) x 2
    Metals NA (SODIUM) x 2

    Jmol

     
    Google Scholar output for 3drw
    1. ADP-dependent 6-Phosphofructokinase from Pyrococcus horikoshii OT3
    MA Currie, F Merino, T Skarina, AHY Wong - Journal of Biological , 2009 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch