.
The Open Protein Structure Annotation Network
PDB Keyword
.

3d01

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the protein Atu1372 with unknown function from Agrobacterium tumefaciens. To be Published
    Site MCSG
    PDB Id 3d01 Target Id APC7131
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS5090,NP_532062.1, 176299 Molecular Weight 16231.87 Da.
    Residues 156 Isoelectric Point 5.32
    Sequence msdviegrlkelgftlpvaaapaanyvpftisgnllyvsgqlpmesgkiavtglvgrdvdvasaqraae lcavnilaqvkaalngdlskirrviklngfvasvpefveqhlvingasnliatvlgepgrharaavgma slpfnasveidaiveidv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 12
    Resolution (Å) 1.70 Rfree 0.21411
    Matthews' coefficent 3.25 Rfactor 0.17888
    Waters 1074 Solvent Content 62.20

    Ligand Information
    Ligands PG5 (1-METHOXY-2-[2-(2-METHOXY-ETHOXY]-ETHANE) x 12
    Metals

    Jmol

     
    Google Scholar output for 3d01
    1. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch