.
The Open Protein Structure Annotation Network
PDB Keyword
.

3c9h

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the substrate binding protein of the ABC transporter from Agrobacterium tumefaciens. To be Published
    Site MCSG
    PDB Id 3c9h Target Id APC6296
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS5068,NP_533139.1, 176299 Molecular Weight 37924.39 Da.
    Residues 343 Isoelectric Point 5.92
    Sequence mriclflclclcmaspalaqvavfpalsgktdaqtlvvyssldeplatpmiegfqkanpdiavhyedml tgeiydrivketdagkktadfafssamdlqvklsndgyaqrsdlamsarwpawanwrntayaltfepav fvyhkpsfttekppatraefvdylerhakevhgriatydiersgvgflfmsrdqeqfgdiwsvikamga agvkvystssailervsdgrfvlgynilgsyaadwasrhpdvgivlpkdytvvmsriglvpeaaanpel grryleffmskegqtimarqlqipavspevagentantmqaihgaqlrpvpvspglmvyldqvkrsr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.22817
    Matthews' coefficent 2.27 Rfactor 0.17259
    Waters 433 Solvent Content 45.91

    Ligand Information
    Ligands CIT (CITRIC) x 2
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 3c9h
    1. A structural classification of substrate-binding proteins
    RPA Berntsson, SHJ Smits, L Schmitt, DJ Slotboom - FEBS letters, 2010 - Elsevier
     
    2. A structural classification of substrate-binding proteins
    PAB Ronnie, SHJ Smits, L Schmitt, DJ Slotboom - FEBS , 2010 - gbb.eldoc.ub.rug.nl
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch