The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a conserved protein of unknown function from Methanobacterium thermoautotrophicum. To be Published
    Site MCSG
    PDB Id 3brc Target Id APC5902
    Molecular Characteristics
    Source Methanothermobacter thermautotrophicus str. delta h
    Alias Ids TPS4914,AAB85633.1, 187420 Molecular Weight 17536.17 Da.
    Residues 156 Isoelectric Point 9.21
    Sequence mledligkaylesaedrrrgdrseeveairkyirsarrtvvpnwnaekvdaindvlrsfnlreaehlqf ntnwadltrmpavtkalmaldisgadlviargrlgvpgsgsllvimdsrgrllsaamspphvihsmevr eavrsemthalerigfkr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.23669
    Matthews' coefficent 2.05 Rfactor 0.18324
    Waters 226 Solvent Content 39.98

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 3


    Google Scholar output for 3brc

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch