The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a possible TetR family transcriptional regulator from Streptomyces coelicolor A3(2). TO BE PUBLISHED
    Site MCSG
    PDB Id 3bqy Target Id APC6288
    Molecular Characteristics
    Source Streptomyces coelicolor a3
    Alias Ids TPS5063,NP_624582.1, 100226 Molecular Weight 23354.96 Da.
    Residues 221 Isoelectric Point 6.30
    Sequence mslpssrtrgrparldrartvqtaldllnesgldtltmrrlaqamdvqagalyryfaakqdlltamaeh mvdgvadaagatgdgdwsertarlaralraallahrdgarvfagthatgpntlrfadglvgvlreagfg dgdaaralysvanftvghtleeqaaltpggggpldeatlreavaagtyphlaatlpvltstdftahfef glrllldglravrq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.95 Rfree 0.210
    Matthews' coefficent 3.32 Rfactor 0.181
    Waters 181 Solvent Content 62.94

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 2;ACY (ACETIC) x 1


    Google Scholar output for 3bqy

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch