.
The Open Protein Structure Annotation Network
PDB Keyword
.

3bjd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative 3-oxoacyl-(acyl-carrier-protein) synthase from Pseudomonas aeruginosa. To be Published
    Site MCSG
    PDB Id 3bjd Target Id APC5632
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4730,AAG06906.1, 208964 Molecular Weight 37518.43 Da.
    Residues 328 Isoelectric Point 5.97
    Sequence mntrnfslpqlqnlpieearivadalavhatsrqidsaasklaalaeaglkgdrqayaayqqllyvlsl sddvataqtrrwlaraiyrveerfmpaadlsralseedfqkrleqeiaaqsrerhpmsqyvfsgsasra qlqvflrhqwfrtfrlyrdaadllvnltdvdeaaalarylygelgeedekgshprllaklleaiglead fqavstmpeeiaylnnrarafrhaevgwglavfyitelvvpgnheklyrallqaglsedqaeyykvhis lvpprakrewqliarripdvqfqnafltslsqhfrverayydaiweemqsvk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.85 Rfree 0.2033
    Matthews' coefficent 2.27 Rfactor 0.1612
    Waters 945 Solvent Content 45.93

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 7
    Metals NI (NICKEL) x 3

    Jmol

     
    Google Scholar output for 3bjd

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch