.
The Open Protein Structure Annotation Network
PDB Keyword
.

3b4u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the dihydrodipicolinate synthase from Agrobacterium tumefaciens. To be Published
    Site MCSG
    PDB Id 3b4u Target Id APC6102
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS5006,NP_533174.1, 176299 Molecular Weight 31252.84 Da.
    Residues 294 Isoelectric Point 5.47
    Sequence mtqkfglsaalttpfktdgtvdidamiaharrclsngcdsvtlfgttgegcsvgsrerqailssfiaag iapsrivtgvlvdsiedaadqsaealnagarnillappsyfknvsddglfawfsavfskigkdardilv ynipsvtmvtlsvelvgrlkaafpgivtgvkdssgnwshterllkehgdlailigderdlargvrlggq gaisgvanfltqevramavdgkddprivdlvvellkfpvtpavkvlvshttgetiwsdvraplvaispe drrqiegafdalfrrqaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.20 Rfree 0.15559
    Matthews' coefficent 2.35 Rfactor 0.12703
    Waters 1354 Solvent Content 47.73

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 3b4u
    1. Biochemical studies and crystal structure determination of dihydrodipicolinate synthase from Pseudomonas aeruginosa
    N Kaur, A Gautam, S Kumar, A Singh, N Singh - International Journal of , 2011 - Elsevier
     
    2. Enzymology of bacterial lysine biosynthesis
    C Dogovski, SC Atkinson - InTech Open Access , 2012 - cdn.intechopen.com
     
    3. Cloning, expression, purification and crystallization of dihydrodipicolinate synthase from Agrobacterium tumefaciens
    SC Atkinson, C Dogovski, RCJ Dobson - Section F: Structural , 2012 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch