.
The Open Protein Structure Annotation Network
PDB Keyword
.

2rir

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of dipicolinate synthase, A chain, from Bacillus subtilis. To be Published
    Site MCSG
    PDB Id 2rir Target Id APC1343
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4533,Q04809, 1423 Molecular Weight 31946.22 Da.
    Residues 297 Isoelectric Point 5.91
    Sequence mltglkiaviggdarqleiirklteqqadiylvgfdqldhgftgavkcnideipfqqidsiilpvsatt gegvvstvfsneevvlkqdhldrtpahcvifsgisnayleniaaqakrklvklferddiaiynsiptve gtimlaiqhtdytihgsqvavlglgrtgmtiartfaalganvkvgarssahlaritemglvpfhtdelk ehvkdidicintipsmilnqtvlssmtpktlildlasrpggtdfkyaekqgikallapglpgivapkta gqilanvlskllaeiqaeegk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.79 Rfree 0.2494
    Matthews' coefficent 3.29 Rfactor 0.1986
    Waters 122 Solvent Content 62.57

    Ligand Information
    Ligands NAP (NADP) x 8
    Metals CL (CHLORIDE) x 7

    Jmol

     
    Google Scholar output for 2rir
    1. A new computationally facile analytical approximation of electrostatic potential suitable for macromolecules.
    JC Gordon - 2007 - scholar.lib.vt.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch