.
The Open Protein Structure Annotation Network
PDB Keyword
.

2rek

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of tetR-family transcriptional regulator. To be Published
    Site MCSG
    PDB Id 2rek Target Id APC6219
    Molecular Characteristics
    Source Streptomyces coelicolor a3
    Alias Ids TPS5039,NP_629219.1, 100226 Molecular Weight 20886.18 Da.
    Residues 199 Isoelectric Point 6.16
    Sequence mswenpgppkradarrnydriieaaaaevarhgadasleeiarragvgsatlhrhfpsrwgllqavfqe rvaqlcdearslaaehppataltrwltslavfgavtrgaarsllpatgtntgaaldsrceqllteagad llaraqedgtvrddvtalellslanavslaaehtpdaahhatrlmgialgglgapgprpqg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.86 Rfree 0.24506
    Matthews' coefficent 2.08 Rfactor 0.2031
    Waters 249 Solvent Content 40.85

    Ligand Information
    Ligands ACT (ACETATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 2rek
    1. Homology modeling of the structure of acyl coA: isopenicillin N-acyltransferase (IAT) from Penicillium chrysogenum. IAT interaction studies with isopenicillin-N,
    L Moreno-Vargas, J Correa-Basurto - Journal of Molecular , 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch