The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of 2'-deoxycytidine 5'-triphosphate deaminase from Agrobacterium tumefaciens. To be Published
    Site MCSG
    PDB Id 2r9q Target Id APC6328
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS5078,NP_531138.1, 176299 Molecular Weight 40521.95 Da.
    Residues 370 Isoelectric Point 6.02
    Sequence mtrttgtrttgiladgairalfagdklkseadldvdqvqpasldlrlgskayrvrasfmpgpgtrvidk lnrfslhevdlsqgavletgcvyivplmeslalpadmsasanpksstgrldiftrvmtdnaqefdkipa gytgplyleisprtfpivvrrgsrlsqirfrighallnesevlklhetetlvasenpnvtgggialsid lkgfgengligyrgkhhtavvdvdkkaqhdvldfweplfargraelildpdefyilvsreavhvpplya aemtpfdplvgefrvhyagffdpgfghaqaggtgsravlevrshevpfilehgqivgrlvyehmlekpe glygtglgsnyqaqglklskhfrae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.20 Rfree 0.26949
    Matthews' coefficent 2.29 Rfactor 0.18904
    Waters 622 Solvent Content 46.23

    Ligand Information


    Google Scholar output for 2r9q

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch