.
The Open Protein Structure Annotation Network
PDB Keyword
.

2r8b

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the protein Atu2452 of unknown function from Agrobacterium tumefaciens str. C58. TO BE PUBLISHED
    Site MCSG
    PDB Id 2r8b Target Id APC6088
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS5000,NP_533124.1, 176299 Molecular Weight 26782.16 Da.
    Residues 247 Isoelectric Point 7.11
    Sequence mprpslrrgeetsgarslheiappaekavrkplnllpfrkdtpmtkdsyfhksragvagaplfvllhgt ggdenqffdfgarllpqatilspvgdvsehgaarffrrtgegvydmvdleratgkmadfikanrehyqa gpviglgfsnganilanvlieqpelfdaavlmhplipfepkispakptrrvlitagerdpicpvqltka leeslkaqggtvetvwhpggheirsgeidavrgflaaygg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.56 Rfree 0.25250
    Matthews' coefficent 2.61 Rfactor 0.19441
    Waters 17 Solvent Content 52.82

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2r8b
    1. Insights into the fatty acid chain length specificity of the carboxylesterase PA3859 from Pseudomonas aeruginosa: A combined structural, biochemical and
    A Pesaresi, D Lamba - Biochimie, 2010 - Elsevier
     
    2. Crystal structure of the predicted phospholipase LYPLAL1 reveals unexpected functional plasticity despite close relationship to acyl protein thioesterases
    M Brger, TJ Zimmermann, Y Kondoh, P Stege - Journal of Lipid , 2012 - ASBMB
     
    3. Crystal structure of the predicted phospholipase LYPLAL1 reveals unexpected functional plasticity in spite of close relationship to acyl protein thioesterases
    M Burger, TJ Zimmermann, Y Kondoh, P Stege - Journal of Lipid , 2011 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch