.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qpv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of uncharacterized protein Atu1531. To be Published
    Site MCSG
    PDB Id 2qpv Target Id APC5868
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS4885,NP_532220.1, 176299 Molecular Weight 14523.58 Da.
    Residues 134 Isoelectric Point 4.39
    Sequence mpvmqsriihlsvekpwaevydfaanpgnmprwaaglaggleadgedwiakggplgevrvnfaphnefg vidhvvtlpdglkvynalrvtpngsgtevsftllrlegmtdedfeqdasaitadlemlksllead
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.35 Rfree 0.24260
    Matthews' coefficent 2.92 Rfactor 0.20878
    Waters 66 Solvent Content 57.90

    Ligand Information
    Ligands ACY (ACETIC) x 2
    Metals

    Jmol

     
    Google Scholar output for 2qpv
    1. Anchored Design of Protein-Protein Interfaces
    SM Lewis, BA Kuhlman - PloS one, 2011 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch