.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qmo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of dethiobiotin synthetase (bioD) from Helicobacter pylori. To be Published
    Site MCSG
    PDB Id 2qmo Target Id APC5858
    Related PDB Ids 3mle 
    Molecular Characteristics
    Source Helicobacter pylori 26695
    Alias Ids TPS4877,NP_206831.1, 85962 Molecular Weight 24405.86 Da.
    Residues 218 Isoelectric Point 6.64
    Sequence mlfisatntnagkttcarllaqycnacgvktillkpietgvndainhssdahlflqdnrlldrsltlkd isfyryhkvsapliaqqeedpnapidtdnltqrlhnftktydlvivegagglcvpitleenmldfalkl kakmllishdnlglindcllndfllkshqldykiainlkgnntafhsislpyielfntrsnnpivifqq slkvlmsfalk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.47 Rfree 0.179
    Matthews' coefficent 2.11 Rfactor 0.148
    Waters 326 Solvent Content 41.81

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 2

    Jmol

     
    Google Scholar output for 2qmo
    1. Structural characterization of the Mycobacterium tuberculosis biotin biosynthesis enzymes 7, 8-diaminopelargonic acid synthase and dethiobiotin synthetase
    S Dey, JM Lane, RE Lee, EJ Rubin, JC Sacchettini - Biochemistry, 2010 - ACS Publications
     
    2. Structural characterization of Helicobacter pylori dethiobiotin synthetase reveals differences between family members
    PJ Porebski, M Klimecka, M Chruszcz - FEBS , 2012 - Wiley Online Library
     
    3. STRUCTURAL AND FUNCTIONAL STUDIES ON THE HELICOBACTER PYLORI PROTEOME: THE STATE OF THE ART
    G Zanotti, L Cendron - Functional Proteomics & Nanotechnology- , 2010 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch