.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qko

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of tetR family protein. To be Published
    Site MCSG
    PDB Id 2qko Target Id APC5908
    Molecular Characteristics
    Source Rhodococcus sp. rha1
    Alias Ids TPS4919,RHA06399, 101510 Molecular Weight 21385.21 Da.
    Residues 193 Isoelectric Point 5.71
    Sequence maqnperraalvnaaievlaregargltfravdveanvpkgtasnyfpsrddlfdqvgkriherlgpdp svveesgrkpqnlelaieymqglfgritrdrtgylalqelrleavrrpelrttltrtisenlkrdigfh ldsglpgdrstvlmlylamnalivehltlpgvlegvdterlvadlvtravatpda
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.35 Rfree 0.2733
    Matthews' coefficent 1.90 Rfactor 0.23307
    Waters 97 Solvent Content 35.24

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qko

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch