The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Putative Transcriptional Regulator SCO4942 from Streptomyces coelicolor. To be Published
    Site MCSG
    PDB Id 2pz9 Target Id APC6284
    Molecular Characteristics
    Source Streptomyces coelicolor a3
    Alias Ids TPS5061,NP_629094.1, 100226 Molecular Weight 24515.19 Da.
    Residues 226 Isoelectric Point 6.53
    Sequence mvaypgpmprspspgqtpdaptsgggstdstrqrivaaakeefarhgiagarvdriakqartskervya yfrskealyahvaerettalieatqldpadlpgyagilfdhfaarpdhyrlitwgrlelaesadntsgp lqatiagkldklrdaqriglldpawdpvdvlalinqiamtwagqpeiaaaaadqavdpsvtarraalvt avehmfprpdrdqrpnrlt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.80 Rfree 0.269
    Matthews' coefficent 2.76 Rfactor 0.213
    Waters 10 Solvent Content 55.43

    Ligand Information
    Ligands SO4 (SULFATE) x 4


    Google Scholar output for 2pz9

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch