.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pjs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein Atu1953, protein of unknown function. To be Published
    Site MCSG
    PDB Id 2pjs Target Id APC6054
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS4994,NP_532633.1, 176299 Molecular Weight 12584.68 Da.
    Residues 116 Isoelectric Point 5.39
    Sequence mavrrvvaniatpeparaqafygdilgmpvamdhgwivthaspleahaqvsfareggsgtdvpdlsiev dnfdevharilkaglpieygpvteawgvqrlflrdpfgklinilsha
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.238
    Matthews' coefficent 1.91 Rfactor 0.19361
    Waters 104 Solvent Content 35.49

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 2pjs
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    2. Three_dimensional domain swapping in the protein structure space
    Y Huang, H Cao, Z Liu - Proteins: Structure, Function, and , 2012 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch