.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pd1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of NE2512 protein of unknown function from Nitrosomonas europaea. To be Published
    Site MCSG
    PDB Id 2pd1 Target Id APC7253
    Molecular Characteristics
    Source Nitrosomonas europaea atcc 19718
    Alias Ids TPS5101,NP_842501.1, 228410 Molecular Weight 10340.27 Da.
    Residues 100 Isoelectric Point 5.19
    Sequence mtklalfvrleakpgqeaaladflasalplanaesgttawfalkfgpstfgvfdafadeagrqahlngq iaaalmanaatllssppniekvellaaklpa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.86 Rfree 0.1854
    Matthews' coefficent 2.16 Rfactor 0.1584
    Waters 405 Solvent Content 43.07

    Ligand Information
    Ligands ACT (ACETATE) x 3
    Metals

    Jmol

     
    Google Scholar output for 2pd1
    1. Crystal structure of TTHA0061, an uncharacterized protein from Thermus thermophilus HB8, reveals a novel fold
    T Tanaka, H Niwa, K Yutani, S Kuramitsu - Biochemical and , 2010 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch