.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ozv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of a predicted O-methyltransferase, protein Atu636 from Agrobacterium tumefaciens. TO BE PUBLISHED
    Site MCSG
    PDB Id 2ozv Target Id APC6006
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS4975,NP_531336.1, 176299 Molecular Weight 25515.69 Da.
    Residues 236 Isoelectric Point 6.14
    Sequence mgdgisetidafhrgrfhiiqpkgrghragmdamllaslvaddracriadlgagagaagmavaarleka evtlyersqemaefarrslelpdnaafsarievleadvtlrakarveaglpdehfhhvimnppyndagd rrtpdalkaeahamteglfedwirtasaimvsggqlslisrpqsvaeiiaacgsrfggleitlihprpg edavrmlvtaikgsrarltfraplimhet
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.21399
    Matthews' coefficent 2.05 Rfactor 0.17767
    Waters 511 Solvent Content 40.01

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ozv

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch