.
The Open Protein Structure Annotation Network
PDB Keyword
.

2osu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of probable glutaminase from B. subtilis complexed with its inhibitor 6-diazo-5-oxo-L-norleucine. To be Published
    Site MCSG
    PDB Id 2osu Target Id APC1040
    Related PDB Ids 1mki 
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4484,O31465, 1423 Molecular Weight 36184.67 Da.
    Residues 327 Isoelectric Point 5.43
    Sequence mkelikehqkdinpalqlhdwveyyrpfaangqsanyipalgkvndsqlgicvlepdgtmihagdwnvs ftmqsiskvisfiaacmsrgipyvldrvdveptgdafnsiirleinkpgkpfnpminagaltiasilpg esayekleflysvmetligkrpriheevfrsewetahrnralayylketnfleaeveetlevylkqcam esttedialiglilahdgyhpirheqvipkdvaklakalmltcgmynasgkyaafvgvpaksgvsggim alvppsarreqpfqsgcgigiygpaideygnsltggmllkhmaqewelsif
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.29 Rfree 0.252
    Matthews' coefficent 2.28 Rfactor 0.194
    Waters 232 Solvent Content 46.08

    Ligand Information
    Ligands DON (6-DIAZENYL-5-OXO-L-NORLEUCINE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2osu
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    2. Crystal structure of salt_tolerant glutaminase from Micrococcus luteus K_3 in the presence and absence of its product l_glutamate and its activator Tris
    K Yoshimune, Y Shirakihara, M Wakayama - FEBS , 2010 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    1mki.png
    No description
    41.09 kB22:12, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch