The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of putative TolB from Agrobacterium tumefaciens. TO BE PUBLISHED
    Site MCSG
    PDB Id 2ojh Target Id APC6101
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS5005,NP_532341.1, 176299 Molecular Weight 32870.80 Da.
    Residues 293 Isoelectric Point 4.87
    Sequence mrqstlhtrlstgpggsmrssieifnirtrkmrvvwqtpelfeapnwspdgkylllnsegllyrlslag dpspekvdtgfaticnndhgispdgalyaisdkvefgksaiyllpstggtprlmtknlpsywhgwspdg ksftycgirdqvfdiysmdidsgvetrlthgegrndgpdyspdgrwiyfnssrtgqmqiwrvrvdgssv eritdsaygdwfphpspsgdkvvfvsydadvfdhprdldvrvqlmdmdggnvetlfdlfggqgtmnspn wspdgdefayvryfpve
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.21594
    Matthews' coefficent 2.77 Rfactor 0.17
    Waters 351 Solvent Content 55.65

    Ligand Information
    Ligands ACY (ACETIC) x 2


    Google Scholar output for 2ojh

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch