.
The Open Protein Structure Annotation Network
PDB Keyword
.

2of7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a tetR-family transcriptional regulator from Streptomyces coelicolor A3. To be Published
    Site MCSG
    PDB Id 2of7 Target Id APC7240
    Molecular Characteristics
    Source Streptomyces coelicolor a3
    Alias Ids TPS5097,NP_629129.1, 100226 Molecular Weight 26102.84 Da.
    Residues 235 Isoelectric Point 5.48
    Sequence mtaarsapspagaprpglrerkktrtreairaatyglirqqgyeattveqiaeraevspstvlryfptr edivltdeydpvmaaelaarpagepwsdslrhvlrkalglgageeaelirlrtrllaevpavrarmlen msdtgrmlaraiadrtgldpdglevrivsmslvgglmevsrywaehdheeslaelvdraldalenglpa lresdresdregdrgghredrregprkd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.2927
    Matthews' coefficent 2.15 Rfactor 0.23092
    Waters 53 Solvent Content 42.67

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2of7
    1. Mutual information and variants for protein domain-domain contact prediction
    M Gomes, R Hamer, G Reinert - BMC Research , 2012 - biomedcentral.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch