The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title yheA from Bacillus subtilis. To be Published
    Site MCSG
    PDB Id 2oee Target Id APC1174.2
    Molecular Characteristics
    Source Bacillus subtilis subsp. subtilis str. 168
    Alias Ids TPS4508,CAB12819.1, BIG_161.1, 224308 Molecular Weight 13233.31 Da.
    Residues 113 Isoelectric Point 4.66
    Sequence nfydvaydlenalrgseeftrlknlydevnadesakrmfenfrdvqlrlqqkqmageeitqeevtqaqk tvalvqqhekisqlmeaeqrmsmligelnkiimkpleelygsve
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.96 Rfree 0.24924
    Matthews' coefficent 2.44 Rfactor 0.21662
    Waters 271 Solvent Content 49.64

    Ligand Information
    Metals CA (CALCIUM) x 2


    Google Scholar output for 2oee

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch