.
The Open Protein Structure Annotation Network
PDB Keyword
.

2oeb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of gene product Af1862 from Archaeoglobus fulgidus. To be Published
    Site MCSG
    PDB Id 2oeb Target Id APC6094
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS5003,AAB89393.1, 224325 Molecular Weight 17386.78 Da.
    Residues 155 Isoelectric Point 5.02
    Sequence mdireieqerasfafkvvsdikdkysqnkkvqgkyssyaekaptiilnnglgatlafflsklekpiddv dyksinpesfgnaeniayaflykhlstwlaegngkdsafsgltngedplkyimektaidvaisteeals ilnwikkfakamleeel
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.66 Rfree 0.23358
    Matthews' coefficent 2.19 Rfactor 0.18514
    Waters 149 Solvent Content 43.73

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2oeb
    1. Unification of Cas protein families and a simple scenario for the origin and evolution of CRISPR-Cas systems
    KS Makarova, L Aravind, YI Wolf, EV Koonin - Biology direct, 2011 - biomedcentral.com
     
    2. X_ray crystal structure of a CRISPR_associated RAMP superfamily protein, Cmr5, from Thermus thermophilus HB8
    K Sakamoto, Y Agari, K Agari - Proteins: Structure, , 2009 - Wiley Online Library
     
    3. Modelling Protein Structure Using Discrete Backbone Torsion Angles
    P Smith - 2010 - unsworks.unsw.edu.au
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch