.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o38

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of Putative XRE Family Transcriptional Regulator. To be Published
    Site MCSG
    PDB Id 2o38 Target Id APC6187
    Molecular Characteristics
    Source Rhodopseudomonas palustris cga009
    Alias Ids TPS5026,NP_949161.1, 258594 Molecular Weight 12703.01 Da.
    Residues 116 Isoelectric Point 10.62
    Sequence mvrksidrstaaeitrgignvfadlgmpdaeerqtklrlayalnavidrarlsqaaaaarlginqpkvs alrnyklegfsverlmtllnaldqdveivirkkprsraaarisvvaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.83 Rfree 0.2705
    Matthews' coefficent 1.57 Rfactor 0.20177
    Waters 150 Solvent Content 21.40

    Ligand Information
    Ligands ACY (ACETIC) x 3
    Metals

    Jmol

     
    Google Scholar output for 2o38

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch