.
The Open Protein Structure Annotation Network
PDB Keyword
.

2o30

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Nuclear movement protein from E. cuniculi GB-M1. TO BE PUBLISHED
    Site MCSG
    PDB Id 2o30 Target Id APC5624
    Molecular Characteristics
    Source Encephalitozoon cuniculi gb-m1
    Alias Ids TPS4726,NP_586742, 284813 Molecular Weight 14755.89 Da.
    Residues 131 Isoelectric Point 4.64
    Sequence mpseakytwdqelneiniqfpvtgdadssaikirivgkkicvknqgeividgellhevdvsslwwving dvvdvnvtkkrnewwdsllvgsesvdvqklaenkhadmsmldaearevvekmmhntsgkdse
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.66 Rfree 0.25645
    Matthews' coefficent 1.56 Rfactor 0.21476
    Waters 184 Solvent Content 21.21

    Ligand Information
    Ligands DTT (2,3-DIHYDROXY-1,4-DITHIOBUTANE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2o30
    1. Structural features and chaperone activity of the NudC protein family
    M Zheng, T Cierpicki, AJ Burdette - Journal of Molecular , 2011 - Elsevier
     
    2. The [] active life'of Hsp90 complexes
    C Prodromou - Biochimica et Biophysica Acta (BBA)-Molecular Cell , 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch