.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nzc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of uncharacterized protein TM1266 from Thermotoga maritima. TO BE PUBLISHED
    Site MCSG
    PDB Id 2nzc Target Id APC4648
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS4619,AAD36341, 2336 Molecular Weight 9461.60 Da.
    Residues 82 Isoelectric Point 9.10
    Sequence mekrfyiltivvedrekayrqvnellhnfsedillrvgypvreenmaiiflvlktdndtigalsgklgq isgvrvktvplkr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.95 Rfree 0.25943
    Matthews' coefficent 1.96 Rfactor 0.20778
    Waters 274 Solvent Content 37.37

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1;ACY (ACETIC) x 4;GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 2nzc
    1. Molecular replacement using ab initio polyalanine models generated with ROSETTA
    DJ Rigden, RM Keegan, MD Winn - Acta Crystallographica Section D , 2008 - scripts.iucr.org
     
    2. Searching distant homologs of the regulatory ACT domain in phenylalanine hydroxylase
    J Siltberg-Liberles, A Martinez - Amino acids, 2009 - Springer
     
    3. Crystal structure of the MecA degradation tag
    F Wang, Z Mei, Y Qi, C Yan, S Xiang, Z Zhou - Journal of Biological , 2009 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch