.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nx4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of a TetR-family transcriptional regulator from Rhodococcus sp. To be Published 2006
    Site MCSG
    PDB Id 2nx4 Target Id APC5889
    Molecular Characteristics
    Source Rhodococcus sp. rha1
    Alias Ids TPS4903,RHA06780, 101510 Molecular Weight 21681.48 Da.
    Residues 193 Isoelectric Point 4.73
    Sequence vpklvdhderrrsitaaawrliaargieaanmrdiateagytngalshyfagkdeilrtsyehiseatd rriaealgdatgldalrilcrevmpineeqlleariaaslwpramydeqmaatnrrtmdnwreqmaifl eqareegsvgdidvtivveqllnmmmgmqilgvltpgetsserqlemleqfvaal
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.70 Rfree 0.21831
    Matthews' coefficent 2.48 Rfactor 0.18526
    Waters 611 Solvent Content 50.38

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2nx4
    1. A comprehensive analysis of structural and sequence conservation in the TetR family transcriptional regulators
    Z Yu, SE Reichheld, A Savchenko, J Parkinson - Journal of molecular , 2010 - Elsevier
     
    2. A structural-alphabet-based strategy for finding structural motifs across protein families
    CY Wu, YC Chen, C Lim - Nucleic acids research, 2010 - Oxford Univ Press
     
    3. New insights into the structure, function and evolution of TETR family transcriptional regulators
    Z Yu - 2010 - 142.150.190.46
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch