The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a transcriptional regulator (RHA1_ro04179) from Rhodococcus sp. Rha1. TO BE PUBLISHED
    Site MCSG
    PDB Id 2np5 Target Id APC6249
    Molecular Characteristics
    Source Rhodococcus sp. rha1
    Alias Ids TPS5052,RHA06396, 101510 Molecular Weight 21567.41 Da.
    Residues 203 Isoelectric Point 5.62
    Sequence mrerrysstsperlaaalfdvaaesglegasvrevakragvsigavqhhfstkdemfafalrtlvdkll arlseverggdparalfaamsqllpldearsreahvmaafavraatspslaeirrktlftirtglsavl igigtpeaetraalllatvdglaldaigspalyppeylehaldiqigmilqgadvvpsssielas
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.21946
    Matthews' coefficent 2.06 Rfactor 0.17664
    Waters 421 Solvent Content 40.35

    Ligand Information


    Google Scholar output for 2np5

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch