.
The Open Protein Structure Annotation Network
PDB Keyword
.

2iks

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of N-terminal truncated DNA-binding transcriptionaldual regulator from Escherichia coli K12. To be Published
    Site MCSG
    PDB Id 2iks Target Id APC5943
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS4949,AAC73191.1, 83333 Molecular Weight 33231.92 Da.
    Residues 291 Isoelectric Point 5.68
    Sequence ehnyhpnavaaglragrtrsiglvipdlentsytrianylerqarqrgyqlliacsedqpdnemrcieh llqrqvdaiivstslppehpfyqrwandpfpivaldraldrehftsvvgadqddaemlaeelrkfpaet vlylgalpelsvsflreqgfrtawkddprevhflyansyereaaaqlfekwlethpmpqalfttsfall qgvmdvtlrrdgklpsdlaiatfgdnelldflqcpvlavaqrhrdvaervleivlasldeprkpkpglt rikrnlyrrgvlsrs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.21949
    Matthews' coefficent 2.12 Rfactor 0.17995
    Waters 425 Solvent Content 41.89

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2iks

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch