The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a hypothetical protein PA3499 from Pseudomonas aeruginosa. To be Published
    Site MCSG
    PDB Id 2ig8 Target Id APC5914
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4924,NP_252189.1, 208964 Molecular Weight 15263.59 Da.
    Residues 144 Isoelectric Point 5.11
    Sequence mtavrriraaalpdlpdaswsnallvgeelvmsgmtahpatrqaaergaaldahaqalvvlgkvkalle aagghvgnlyklnvyvtriadkdaigrarqeffagqgtfpastlvevsglvfpellveidawarldidl ancdea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.90 Rfree 0.19898
    Matthews' coefficent 3.60 Rfactor 0.17768
    Waters 476 Solvent Content 65.86

    Ligand Information


    Google Scholar output for 2ig8

    Protein Summary

    Ligand Summary




    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch