.
The Open Protein Structure Annotation Network
PDB Keyword
.

2id3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title
    Site MCSG
    PDB Id 2id3 Target Id APC6241
    Molecular Characteristics
    Source Streptomyces coelicolor a3
    Alias Ids TPS5050,NP_630068.1, 100226 Molecular Weight 21240.58 Da.
    Residues 203 Isoelectric Point 5.47
    Sequence mpdpaapgtlrpggrtarireavllaagdalaadgfdaldlgeiarragvgkttvyrrwgtpgglaadl ladmaeqslpradtgaleedlranarlvvrtlddprqgrlfraliaaslcneqaaealhrfyavrvdew agcvrdavargevpdgtdphgvvaavsaplyyallntgrslteadadraaraastaaragvwvtg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.19876
    Matthews' coefficent 2.60 Rfactor 0.16437
    Waters 481 Solvent Content 52.00

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 3;CA (CALCIUM) x 8

    Jmol

     
    Google Scholar output for 2id3

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch