.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ibd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Probable transcriptional regulatory protein RHA5900. To be Published
    Site MCSG
    PDB Id 2ibd Target Id APC5995
    Molecular Characteristics
    Source Rhodococcus sp. rha1
    Alias Ids TPS4969,RHA05900, 101510 Molecular Weight 22549.01 Da.
    Residues 204 Isoelectric Point 4.86
    Sequence mtpppaddtsgksgrrtelldiaatlfaerglrattvrdiadaagilsgslyhhfdskesmvdeilrgf lddlfgkyreivasgldsratlealvttsyeaidashsavaiyqdevkhlvanerftylselntefrel wmgvleagvkdgsfrsdidvelafrflrdtawvavrwyrpggsvtvdtvakqylsivldglasphn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.50 Rfree 0.20077
    Matthews' coefficent 2.24 Rfactor 0.16811
    Waters 485 Solvent Content 45.11

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 2ibd
    1. Structural plasticity and distinct drug-binding modes of LfrR, a mycobacterial efflux pump regulator
    M Bellinzoni, S Buroni, F Schaeffer - Journal of , 2009 - Am Soc Microbiol
     
    2. Transcriptional repression mediated by a TetR family protein, PfmR, from Thermus thermophilus HB8
    Y Agari, K Sakamoto, S Kuramitsu - Journal of , 2012 - Am Soc Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch