.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i9c

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Protein RPA1889 from Rhodopseudomonas palustris CGA009. To be Published
    Site MCSG
    PDB Id 2i9c Target Id APC6185
    Molecular Characteristics
    Source Rhodopseudomonas palustris cga009
    Alias Ids TPS5025,NP_947234.1, 258594 Molecular Weight 13653.02 Da.
    Residues 123 Isoelectric Point 5.08
    Sequence mskldlhqmttqdlvalfakvtveqddallgnqisrfnrlfgvmaeiadelkardgdqrtallslfeyp nmqvrlqaakltlavapvkareqleaivsskwfpqagdagmcldllddgtfkpk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.20189
    Matthews' coefficent 2.46 Rfactor 0.17472
    Waters 92 Solvent Content 50.05

    Ligand Information
    Ligands ACT (ACETATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 2i9c
    1. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    2. Reconstruction of Protein Backbone with the alpha-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - Journal of Information Science , 2010 - etd.lib.nsysu.edu.tw
     
    3. Geometry, thermodynamics, and protein
    Y Fang, J Jing - Journal of theoretical biology, 2010 - Elsevier
     
    4. Composite approaches to protein tertiary structure prediction: A case-study by I-TASSER
    A Roy, S Wu, Y Zhang - Introduction to Protein Structure , 2010 - books.google.com
     
    5. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     
    6. The Fragment-based Consistency Score in Model Quality Assessment for De Novo Prediction of Protein Structures
    H Cetin, TN Sasaki, M Sasai - Chem-Bio Informatics Journal, 2011 - J-STAGE
     
    7. Reconstruction of Protein Backbone with the a-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - 2007 - asiair.asia.edu.tw
     
    8. ___________________________________
    H Cetin_ _____ ____ - CBI _____, 2011 - J-STAGE
     
    9. Refinement of All-atom Backbone Prediction of Proteins
    HY Chang - 2008 - etd.lib.nsysu.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch